Invitrogen™ Human uPAR (aa 51-156) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP102358	100 μL

Catalog No. RP102358 Supplier Invitrogen™ Supplier No. RP102358

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (54%), Rat (54%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The urokinase-type plasminogen activator receptor is a key molecule in the regulation of cell-surface plasminogen activation and plays an important role in many normal as well as pathologic processes. The human PLAUR cDNA encodes 335 amino acids including a predicted signal peptide of 22 residues and a hydrophobic C-terminal portion. It produces a highly glycosylated protein of about 50 kD in monocytes where it is anchored to the plasma membrane by glycosyl-phosphatidylinositol linkage. PLAUR, also known as UPAR, is directly associated with the carbohydrate-binding domain of SELL in the membrane of neutrophils, an association analogous to that between PLAUR and beta-2 integrins. PLAUR-mediated calcium mobilization is SELL dependent. UPAR mRNA levels correlate with the invasive potential of endometrial carcinomas and show a 33-fold increase in UPAR mRNA levels in advanced clinical stage endometrial tumors compared with normal endometrial tissue. Furthermore, the increase in UPAR mRNA levels correlated linearly with the progression of disease stage. UPAR protein expressioin correlated positively with rate of recurrence and mortality in patients with endometrial cancer. UPAR appears to be a useful prognostic marker for advanced endometrial cancer.

Specifications

• Accession Number: Q03405
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5329
• Name: Human uPAR (aa 51-156) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Cd87; MO3; Monocyte activation antigen Mo3; Par; plasminogen activator urokinase receptor 3; plasminogen activator, urokinase receptor; PLAUR; Plaur3; sCD87; soluble CD87; uPAR; U-PAR; uPAR-2; uPAR-3; u-plasminogen activator receptor form 2; urinary plasminogen activator receptor 2; urinary plasminogen activator receptor 3; URKR; urokinase plasminogen activator receptor; urokinase plasminogen activator surface receptor; urokinase-type plasminogen activator (uPA) receptor; urokinase-type plasminogen activator receptor
• Common Name: uPAR (CD87)
• Gene Symbol: PLAUR
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining