Invitrogen™ Human UPF1 (aa 265-351) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP91824	100 μL

Catalog No. RP91824 Supplier Invitrogen™ Supplier No. RP91824

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54031. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Upf1 was identified as an active component in nonsense-mediated decay (NMD), an mRNA surveillance mechanism in eukaryotic cells that degrades mRNAs containing premature termination codons. Upf1 was found to be an ATP-dependent RNA helicase in the cytoplasm and was later shown to be a component of cytoplasmic P-bodies. Upf1 phosphorylation mediates the repression of translation that accompanies NMD, allowing mRNA accessibility to the NMD machinery. Two other active components of NMD, Upf2 and Upf3, were also identified and described as having perinuclear and nucleocytoplasmic localization, respectively.

Specifications

• Accession Number: Q92900
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 5976
• Name: Human UPF1 (aa 265-351) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: ATP-dependent helicase RENT1; B430202H16Rik; delta helicase; FLJ43809; FLJ46894; HUPF1; KIAA0221; LOW QUALITY PROTEIN: regulator of nonsense transcripts 1; mUpf1; Nonsense mRNA reducing factor 1; NORF1; pNORF1; PNORF-1; Regulator of nonsense transcripts 1; Regulator of nonsense transcripts 1 (Nonsense mRNA reducing factor 1) (NORF1) (Up-frameshift suppressor 1 homolog); Rent1; smg-2; smg-2 homolog, nonsense mediated mRNA decay factor; Upf1; UPF1 regulator of nonsense transcripts homolog; UPF1 regulator of nonsense transcripts homolog (yeast); UPF1 RNA helicase and ATPase; UPF1, RNA helicase and ATPase; Upflp; up-frameshift mutation 1 homolog; up-frameshift suppressor 1 homolog; wu:fi40f07; wu:fj48a01; yeast Upf1p homolog; zgc:55472
• Common Name: UPF1
• Gene Symbol: UPF1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LEELWKENPSATLEDLEKPGVDEEPQHVLLRYEDAYQYQNIFGPLVKLEADYDKKLKESQTQDNITVRWDLGLNKKRIAYFTLPKTD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining