Invitrogen™ Human UPF3B (aa 2-132) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP92137	100 μL

Catalog No. RP92137 Supplier Invitrogen™ Supplier No. RP92137

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51652. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

UPF3B is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. The protein is one of two functional homologs to yeast Upf3p. This protein binds to the mRNA and remains bound after nuclear export, acting as a nucleocytoplasmic shuttling protein. It forms with Y14 a complex that binds specifically 20 nt upstream of exon-exon junctions. This gene encodes a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. The encoded protein is one of two functional homologs to yeast Upf3p. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD). When translation ends upstream from the last exon-exon junction, this triggers NMD to degrade mRNAs containing premature stop codons. This protein binds to the mRNA and remains bound after nuclear export, acting as a nucleocytoplasmic shuttling protein. It forms with Y14 a complex that binds specifically 20 nt upstream of exon-exon junctions. This gene is located on the long arm of chromosome X. Two splice variants encoding different isoforms have been found for this gene.

Specifications

• Accession Number: Q9BZI7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 65109
• Name: Human UPF3B (aa 2-132) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 5730594O13Rik; AI317193; AW541158; HUPF3B; hUpf3p-X; mental retardation, X-linked 62; MRX62; MRXS14; Nonsense mRNA reducing factor 3B; regulator of nonsense transcripts 3B; RENT3B; RGD1560264; Unknown (protein for MGC:134301); UPF3 regulator of nonsense transcripts homolog B; UPF3 regulator of nonsense transcripts homolog B (yeast); UPF3 regulator of nonsense transcripts-like protein B; UPF3B; UPF3B pseudogene 1; UPF3B pseudogene 2; UPF3B pseudogene 3; UPF3B regulator of nonsense mediated mRNA decay; UPF3BP1; UPF3BP2; UPF3BP3; Upf3p-X; UPF3X; up-frameshift suppressor 3 homolog B; Up-frameshift suppressor 3 homolog on chromosome X
• Common Name: UPF3B
• Gene Symbol: UPF3B
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KEEKEHRPKEKRVTLLTPAGATGSGGGTSGDSSKGEDKQDRNKEKKEALSKVVIRRLPPTLTKEQLQEHLQPMPEHDYFEFFSNDTSLYPHMYARAYINFKNQEDIILFRDRFDGYVFLDNKGQEYPAIVE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining