Invitrogen™ Human USP10 Control Fragment Recombinant Protein

Catalog No.	Quantity
RP89242	100 μL

Catalog No. RP89242 Supplier Invitrogen™ Supplier No. RP89242

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (64%), Rat (64%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52334. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

USP10, also known as ubiquitin specific peptidase 10, belongs to the ubiquitin-specific protease family of cysteine proteases. USP10 functions to catalyze the cleavage of ubiquitin from ubiquitin-conjugated protein substrates such as p53/TP53, SNX3 and CFTR. USP10 has been identified as a subunit of DNA-bound androgen receptor (AR) complexes and may play a role in the activity of the DNA-bound androgen receptor complex. USP10 also acts as an essential regulator of p53/TP53 stability and is thought to function as a tumor suppressor.

Specifications

• Accession Number: Q14694
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 9100
• Name: Human USP10 Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 2610014N07Rik; Deubiquitinating enzyme 10; KIAA0190; MGC2621; mKIAA0190; Ode-1; ubiquintin c-terminal hydrolase related polypeptide; ubiquitin carboxyl-terminal hydrolase 10; ubiquitin specific peptidase 10; ubiquitin specific protease 10; ubiquitin thioesterase 10; ubiquitin thiolesterase 10; ubiquitin-specific-processing protease 10; UBPO; Uchrp; USP10
• Common Name: USP10
• Gene Symbol: Usp10
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KITPDGITKEASYGSIDCQYPGSALALDGSSNVEAEVLENDGVSGGLGQRERKKKKKRPPGYYSYLKDGGDDSISTEALVNGHANSAVPNSVSAEDAEFMGDMPPPLTPRTCNSPQNSTDS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining