Invitrogen™ Human USP8 (aa 75-194) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP106263	100 μL

Catalog No. RP106263 Supplier Invitrogen™ Supplier No. RP106263

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (78%), Rat (78%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111308. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

USP8 is a ubiquitin specific protease that plays an important regulatory role at the level of protein turnover by preventing degradation. USP8 is involved in cell proliferation, and probably regulates the stability of STAM2 and RASGRF1. USP8 may regulate T-cell energy mediated by RNF128 via the formation of a complex containing RNF128 and STAM2. As revealed by structure/function studies, USP8 forms a ternary complex with RNF128 and OTUB1, and interacts with the SH3 domain of STAM2 and RASGRF1. Expression of USP8 is induced Upon growth stimulation in starved human fibroblasts, and expression decreases in response to growth arrest induced by cell-cell contact.

Specifications

• Accession Number: P40818
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 9101
• Name: Human USP8 (aa 75-194) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: AI574262; AW557536; Deubiquitinating enzyme 8; hUBPy; HumORF8; Kiaa0055; mKIAA0055; mUBPy; putative deubiquitinating enzyme; SPG59; Ubiquitin carboxyl-terminal hydrolase 8; ubiquitin isopeptidase Y; ubiquitin specific peptidase 8; ubiquitin specific protease 8; ubiquitin thioesterase 8; ubiquitin thiolesterase 8; ubiquitin-specific-processing protease 8; Ubpy; USP8
• Common Name: USP8
• Gene Symbol: USP8
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KRPDFKQQQDYFHSILGPGNIKKAVEEAERLSESLKLRYEEAEVRKKLEEKDRQEEAQRLQQKRQETGREDGGTLAKGSLENVLDSKDKTQKSNGEKNEKCETKEKGAITAKELYTMMTD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining