Invitrogen™ Human VDAC (aa 74-207) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP102574	100 μL

Catalog No. RP102574 Supplier Invitrogen™ Supplier No. RP102574

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Voltage-dependent anion channel (VDAC) proteins are abundant, pore-forming proteins belonging to the eukaryotic mitochondrial porins. It was discovered in the mitochondrial outer membrane. It also is expressed in the plasma membrane. At least three different VDAC genes have been identified in vertebrates. VDAC proteins are known to play an essential role in cellular metabolism and in the early stages of apoptosis. For example, VDAC constitutes a major pathway by which metabolites such as ADP/ATP, succinate and citrate are exchanged between the cytosol and mitochondria. And VDAC1 in the plasma membrane establishes a novel level of apoptosis regulation putatively via its redox activity.

Specifications

• Accession Number: P21796
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 7416
• Name: Human VDAC (aa 74-207) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: AL033343; BR1-VDAC; Brain-derived voltage-dependent anion channel 1; hVDAC1; MGC111064; Mitochondrial outer membrane protein porin 1; Mitochondrial Porin; mVDAC1; mVDAC5; N2441; OMP2; Outer mitochondrial membrane protein porin 1; plasmalemmal porin; POR1; PORIN; Porin 31HL; porin 31HM; porin POR1; PORIN-31-HL; rVDAC1; VD; VDAC; VDAC1; VDAC-1; Vdac5; VDAC-5; voltage dependent anion channel 1; voltage-dependent anion channel 1; voltage-dependent anion-selective channel protein 1; Voltage-dependent anion-selective channel protein 5; YNL055C; YNL2441C
• Common Name: VDAC
• Gene Symbol: VDAC1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KWNTDNTLGTEITVEDQLARGLKLTFDSSFSPNTGKKNAKIKTGYKREHINLGCDMDFDIAGPSIRGALVLGYEGWLAGYQMNFETAKSRVTQSNFAVGYKTDEFQLHTNVNDGTEFGGSIYQKVNKKLETAVN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining