Invitrogen™ Human VEGF Receptor 1 (aa 619-739) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP108143	100 μL

Catalog No. RP108143 Supplier Invitrogen™ Supplier No. RP108143

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FLT1 (VEGFR1) is a receptor tyrosine kinase which plays a critical role in angiogenesis. Active angiogenesis has been found to play important role in many pathological and physiological processes, such as tumor progression, diabetic retinopathy, rheumatoid arthritis and wound healing. May play an essential role as a negative regulator of embryonic angiogenesis by inhibiting excessive proliferation of endothelial cells. Can promote endothelial cell proliferation, survival and angiogenesis in adulthood. Its function in promoting cell proliferation seems to be cell-type specific. Promotes PGF-mediated proliferation of endothelial cells, proliferation of some types of cancer cells, but does not promote proliferation of normal fibroblasts (in vitro). Has very high affinity for VEGFA and relatively low protein kinase activity; may function as a negative regulator of VEGFA signaling by limiting the amount of free VEGFA and preventing its binding to KDR.

Specifications

• Accession Number: P17948
• Concentration: 3.80 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 2321
• Name: Human VEGF Receptor 1 (aa 619-739) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: AI323757; embryonic receptor kinase 2; Emrk2; FLT; FLT1; FLT-1; fms related tyrosine kinase 1; FMS-like tyrosine kinase 1; FMS-related tyrosine kinase 1; Fms-related tyrosine kinase 1 (vascular endothelial growth factor/vascular permeability factor receptor); FRT; i21; sFlt1; soluble VEGFR 1; sVEGFR 1; Tyrosine-protein kinase FRT; tyrosine-protein kinase receptor FLT; Vascular endothelial growth factor receptor 1; vascular endothelial growth factor receptor-1; vascular permeability factor receptor; VEGF R1; VEGFR1; VEGFR-1
• Common Name: VEGF Receptor 1
• Gene Symbol: FLT1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LNLTIMNVSLQDSGTYACRARNVYTGEEILQKKEITIRDQEAPYLLRNLSDHTVAISSSTTLDCHANGVPEPQITWFKNNHKIQQEPGIILGPGSSTLFIERVTEEDEGVYHCKATNQKGS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining