Invitrogen™ Human VGLUT1 (aa 264-294) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP103521	100 μL

Catalog No. RP103521 Supplier Invitrogen™ Supplier No. RP103521

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

A Na(+)-dependent inorganic phosphate cotransporter; may be involved in neuronal Na+ transport.

Specifications

• Accession Number: Q9P2U7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 57030
• Name: Human VGLUT1 (aa 264-294) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 2900052E22Rik; AI851913; BNPI; Brain-specific Na(+)-dependent inorganic phosphate cotransporter; brain-specific Na-dependent inorganic phosphate cotransporter; SLC17A1; SLC17A1/VGLUT1; Slc17a7; solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 7; solute carrier family 17 (vesicular glutamate transporter), member 7; solute carrier family 17 member 7; Vesicular glutamate transporter 1; VGlU1; VGLUT 1; VGLUT1
• Common Name: VGLUT1
• Gene Symbol: SLC17A7
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PSISEEERKYIEDAIGESAKLMNPLTKFSTP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining