Invitrogen™ Human VLK (aa 407-487) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP95072	100 μL

Catalog No. RP95072 Supplier Invitrogen™ Supplier No. RP95072

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110916. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

VLK was identified as a novel protein kinase that was induced after the differentiation of cultured embryonic stem cells into mesendoderm. It has no homologs in invertebrates, but is highly conserved in vertebrate species although it does not belong to any known protein kinase groups. VLK is initially expressed in E-cadherin-positive anterior visceral endoderm and mesendoderm, but its expression is later confined to E-cadherin-negative mesenchyme. It is enriched in the Golgi apparatus and is thought to regulate the rate of protein export from the Golgi. Targeted disruption of VLK in mice leads to a defect in lung development and neonatal lethality. It has been suggested that mutations in VLK may be associated with the allergic condition atopy.

Specifications

• Accession Number: Q504Y2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 91461
• Name: Human VLK (aa 407-487) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: Adtk1; AI115348; AW548124; ESTM17; Extracellular tyrosine-protein kinase PKDCC; MAd1; Pkdcc; protein kinase domain containing, cytoplasmic; protein kinase domain containing, cytoplasmic homolog; protein kinase domain-containing protein, cytoplasmic; Protein kinase-like protein SgK493; RGD1311939; SGK493; Sugen kinase 493; vertebrate lonesome kinase; Vlk; X83346
• Common Name: VLK
• Gene Symbol: PKDCC
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TEYQCIPDSTIPQEDYRCWPSYHHGSCLLSVFNLAEAVDVCESHAQCRAFVVTNQTTWTGRQLVFFKTGWSQVVPDPNKTT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining