Invitrogen™ Human VPS25 (aa 89-169) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP93262	100 μL

Catalog No. RP93262 Supplier Invitrogen™ Supplier No. RP93262

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-144727, PA5-63427. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

VPS25 (Vacuolar Protein Sorting 25 Homolog) is a Protein Coding gene. Among its related pathways are Delta508-CFTR traffic / ER-to-Golgi in CF and Budding and maturation of HIV virion. Gene Ontology (GO) annotations related to this gene include protein homodimerization activity and protein N-terminus binding.

Specifications

• Accession Number: Q9BRG1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 84313
• Name: Human VPS25 (aa 89-169) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 1110020N13Rik; AW107467; D11Wsu68e; dermal papilla-derived protein 9; DERP9; Eap20; ELL-associated protein of 20 kDa; ESCRT-II complex subunit VPS25; FAP20; HGNC:28122; hVps25; MGC10540; vacuolar protein sorting 25 (yeast); vacuolar protein sorting 25 homolog; vacuolar protein sorting 25 homolog (S. cerevisiae); vacuolar protein-sorting-associated protein 25; VPS25
• Common Name: VPS25
• Gene Symbol: VPS25
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: WLDKSKSSFLIMWRRPEEWGKLIYQWVSRSGQNNSVFTLYELTNGEDTEDEEFHGLDEATLLRALQALQQEHKAEIITVSD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining