Invitrogen™ Human VPS36 (aa 74-145) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP97973	100 μL

Catalog No. RP97973 Supplier Invitrogen™ Supplier No. RP97973

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58905. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

VPS36, VPS22, and VPS25 (Slagsvold et al., 2005 ; Kamura et al., 2001 ).

Specifications

• Accession Number: Q86VN1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 51028
• Name: Human VPS36 (aa 74-145) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 1700010A24Rik; 2210415M20Rik; 2810408E15Rik; C13orf9; CGI-145; EAP45; ELL-associated protein of 45 kDa; ESCRT-II complex subunit VPS36; RGD1309754; vacuolar protein sorting 36 (yeast); vacuolar protein sorting 36 homolog; vacuolar protein sorting 36 homolog (S. cerevisiae); vacuolar protein-sorting-associated protein 36; VPS36
• Common Name: VPS36
• Gene Symbol: VPS36
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: AGIGKSAKIVVHLHPAPPNKEPGPFQSSKNSYIKLSFKEHGQIEFYRRLSEEMTQRRWENMPVSQSLQTNRG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining