Invitrogen™ Human VPS37A (aa 226-311) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP93841	100 μL

Catalog No. RP93841 Supplier Invitrogen™ Supplier No. RP93841

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55160. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene belongs to the VPS37 family, and encodes a component of the ESCRT-I (endosomal sorting complex required for transport I) protein complex, required for the sorting of ubiquitinated transmembrane proteins into internal vesicles of multivesicular bodies. Expression of this gene is downregulated in hepatocellular carcinoma, and mutations in this gene are associated with autosomal recessive spastic paraplegia-53. A related pseudogene has been identified on chromosome 5. Alternatively spliced transcript variants have been found for this gene.

Specifications

• Accession Number: Q8NEZ2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 137492
• Name: Human VPS37A (aa 226-311) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 2210018P21Rik; 4930592A21Rik; AW261445; D8Ertd531e; ESCRT-I complex subunit VPS37A; HCRP1; Hepatocellular carcinoma-related protein 1; hVps37A; polyglutamine binding protein 2; PQBP2; SPG53; vacuolar protein sorting 37 homolog A; vacuolar protein sorting 37 homolog A (S. cerevisiae); vacuolar protein sorting 37A; vacuolar protein sorting 37A (yeast); vacuolar protein sorting-associated protein 37A; Vps37A; VPS37A, ESCRT-I subunit
• Common Name: VPS37A
• Gene Symbol: Vps37a
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DVPDAFPELSELSVSQLTDMNEQEEVLLEQFLTLPQLKQIITDKDDLVKSIEELARKNLLLEPSLEAKRQTVLDKYELLTQMKSTF
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining