Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ Human VPS41 (aa 722-852) Control Fragment Recombinant Protein

Catalog No. RP92601
Encompass_Preferred
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP92601 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP92601 Supplier Invitrogen™ Supplier No. RP92601
Add to Cart
Add to Cart

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54138. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Vesicle mediated protein sorting plays an important role in segregation of intracellular molecules into distinct organelles. Genetic studies in yeast have identified more than 40 vacuolar protein sorting (VPS) genes involved in vesicle transport to vacuoles. This gene encodes the human ortholog of yeast Vps41 protein which is also conserved in Drosophila, tomato, and Arabidopsis. Expression studies in yeast and human indicate that this protein may be involved in the formation and fusion of transport vesicles from the Golgi. Several transcript variants encoding different isoforms have been described for this gene, however, the full-length nature of not all is known.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P49754
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 27072
Name Human VPS41 (aa 722-852) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias AI317346; fa01f11; HVPS41; hVps41p; HVSP41; mVam2; RGD1560511; S53; si:ch211-146l10.2; vacuolar assembly protein 41; vacuolar protein sorting 41 (yeast); vacuolar protein sorting 41 homolog; vacuolar protein sorting 41 homolog (S. cerevisiae); vacuolar protein sorting-associated protein 41 homolog; Vam2; VAM2 homolog; VPS41; VPS41 HOPS complex subunit; VPS41 subunit of HOPS complex; VPS41, HOPS complex subunit; wu:fa01f11
Common Name VPS41
Gene Symbol VPS41
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence DPILLIHRIKEGMEIPNLRDSLVKILQDYNLQILLREGCKKILVADSLSLLKKMHRTQMKGVLVDEENICESCLSPILPSDAAKPFSVVVFHCRHMFHKECLPMPSMNSAAQFCNICSAKNRGPGSAILEM
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.