Invitrogen™ Human VPS54 (aa 577-664) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP105029	100 μL

Catalog No. RP105029 Supplier Invitrogen™ Supplier No. RP105029

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65985. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes for a protein that in yeast forms part of a trimeric vacuolar-protein-sorting complex that is required for retrograde transport of proteins from prevacuoles to the late Golgi compartment. As in yeast, mammalian Vps54 proteins contain a coiled-coil region and dileucine motifs. Alternative splicing results in multiple transcript variants encoding different isoforms.

Specifications

• Accession Number: Q9P1Q0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 51542
• Name: Human VPS54 (aa 577-664) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: Hcc8; Hepatocellular carcinoma protein 8; hVps54L; mSLP8; PPP1R164; protein phosphatase 1, regulatory subunit 164; SLP-8p; Tumor antigen HOM-HCC-8; tumor antigen SLP-8p; Tumor antigen SLP-8p homolog; vacuolar protein sorting 54 (yeast); vacuolar protein sorting 54 homolog; vacuolar protein sorting 54 homolog (S. cerevisiae); vacuolar protein sorting-associated protein 54; VPS54; VPS54 GARP complex subunit; VPS54, GARP complex subunit; Vps54l; vps54-like protein; Vsp54; wr
• Common Name: VPS54
• Gene Symbol: Vps54
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VDIMVSEDMKLTDSELGKLANNIQELLYSASDICHDRAVKFLMSRAKDGFLEKLNSMEFITLSRLMETFILDTEQICGRKSTSLLGAL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining