Invitrogen™ Human WDHD1 (aa 231-345) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP88907	100 μL

Catalog No. RP88907 Supplier Invitrogen™ Supplier No. RP88907

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene contains multiple N-terminal WD40 domains and a C-terminal high mobility group (HMG) box. WD40 domains are found in a variety of eukaryotic proteins and may function as adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly. HMG boxes are found in many eukaryotic proteins involved in chromatin assembly, transcription and replication. Alternative splicing results in two transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008].

Specifications

• Accession Number: O75717
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 11169
• Name: Human WDHD1 (aa 231-345) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: A630092E18; Acidic nucleoplasmic DNA-binding protein 1; AND1; And-1; CHTF4; crm1; CRM1/XPO1 protein; CTF4; CTF4, chromosome transmission fidelity factor 4 homolog; D630024B06Rik; exportin 1 (CRM1 homolog); exportin 1 S homeolog; exportin-1; WD repeat and HMG-box DNA binding protein 1; WD repeat and HMG-box DNA-binding protein 1; WD repeat and HMG-box DNA-binding protein 1-like protein; WDHD1; XELAEV_18028477mg; Xpo; xpo1; xpo1.S
• Common Name: WDHD1
• Gene Symbol: Wdhd1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QTLNIVTWSPCGQYLAAGSINGLIIVWNVETKDCMERVKHEKGYAICGLAWHPTCGRISYTDAEGNLGLLENVCDPSGKTSSSKVSSRVEKDYNDLFDGDDMSNAGDFLNDNAVE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining