Invitrogen™ Human WDR35 (aa 530-634) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP99642	100 μL

Catalog No. RP99642 Supplier Invitrogen™ Supplier No. RP99642

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60629. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

WD40 repeats are a common structural module in eukaryotic proteins, and proteins containing WD40 domains have a wide range of functions, including signal transduction, cell cycle regulation, RNA splicing, and transcription. One such protein, WDR35, also known as CED2, has been shown to be mutated in patients with Sensenbrenner syndrome/cranioectodermal dysplasia (CED), an autosomal-recessive disease that is characterized by craniosynstosis and ectodermal and skeletal abnormalities. WDR35 localizes to cilia and dentrosomes during embryogenesis and human and mouse fibroblasts that lack this gene fail to produce cilia. Mutations in this gene can also cause short-rib polydactyly syndromes due to abnormal ciliogenesis.

Specifications

• Accession Number: Q9P2L0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 57539
• Name: Human WDR35 (aa 530-634) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 4930459M12Rik; 4931430C06; CED2; IFT121; IFTA1; intraflagellar transport protein 121 homolog; KIAA1336; mKIAA1336; Naofen; RGD1564116; SRTD7; WD repeat domain 35; WD repeat domain 35-like; WD repeat-containing protein 35; WDR35; Wdr35l
• Common Name: WDR35
• Gene Symbol: WDR35
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SLPNVGLIQKYSLNCRAYQLSLNCNSSRLAIIDISGVLTFFDLDARVTDSTGQQVVGELLKLERRDVWDMKWAKDNPDLFAMMEKTRMYVFRNLDPEEPIQTSGY
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining