Invitrogen™ Human WDR63 (aa 422-512) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP94394	100 μL

Catalog No. RP94394 Supplier Invitrogen™ Supplier No. RP94394

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58426. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

WDR63 contains 5 WD repeats. The exact function of WDR63 is not known.

Specifications

• Accession Number: Q8IWG1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 126820
• Name: Human WDR63 (aa 422-512) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: DIC3; NYD-SP29; testicular tissue protein Li 225; Testis development protein NYD-SP29; testis development protein NYD-SP29 (NYD-SP29); WD repeat domain 63; WD repeat-containing protein 63; WDR63
• Common Name: WDR63
• Gene Symbol: WDR63
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: IVMWDITAHADRIENIKAGGSRSKRATLKPMFLLEPESNKEAMYIRHCAVSSIENGHKKVITDIHWLSDTFEINRMGSVFENRSGICCQLV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining