Invitrogen™ Human WDR65 (aa 1165-1250) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP94575	100 μL

Catalog No. RP94575 Supplier Invitrogen™ Supplier No. RP94575

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (70%), Rat (70%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55922. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The WDR65 gene, which stands for WD Repeat Domain 65, encodes a protein characterized by the presence of WD repeat domains that facilitate protein-protein interactions. This gene is implicated in the assembly of a subset of inner arm dyneins, critical for ciliary motility and axonemal structure. Mutations in WDR65 have been associated with diseases such as Van der Woude syndrome (VWS) and related craniofacial disorders, highlighting its role in developmental processes. Specifically, a missense mutation in WDR65 was identified as a potential cause of VWS, suggesting that WDR65 is a target for regulatory factors like IRF6.

Specifications

• Accession Number: Q96MR6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 149465
• Name: Human WDR65 (aa 1165-1250) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: CFAP57; cilia and flagella associated protein 57; cilia- and flagella-associated protein 57; VWS2; WD repeat-containing protein 65; WDR65
• Common Name: WDR65
• Gene Symbol: CFAP57
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LKLTKKVRPQEVSETEPSRDMLSTAPTARLNEQEETGRIIEMQRLEIQRLRDQIQEQEQVTGFHTLAGVRLPSLSNSEVDLEVKTN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining