Invitrogen™ Human WFDC2 (aa 31-124) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP102456	100 μL

Catalog No. RP102456 Supplier Invitrogen™ Supplier No. RP102456

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (63%), Rat (63%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83602. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a protein that is a member of the WFDC domain family. The WFDC domain, or WAP Signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor in many family members. This gene is expressed in pulmonary epithelial cells, and was also found to be expressed in some ovarian cancers. The encoded protein is a small secretory protein, which may be involved in sperm maturation.

Specifications

• Accession Number: Q14508
• Concentration: 2.11 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 10406
• Name: Human WFDC2 (aa 31-124) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 1600023A02Rik; dJ461P17.6; EDDM4; epididymal protein 4; epididymal secretory protein 4; Epididymal secretory protein E4; epididymis-specific, whey-acidic protein type, four-disulfide core; HE4; Major epididymis-specific protein E4; MGC57529; putative protease inhibitor WAP5; RE4; WAP domain containing protein HE4-V4; WAP domain-containing protein HE4; WAP four-disulfide core domain 2; WAP four-disulfide core domain protein 2; WAP5; Wfdc2
• Common Name: WFDC2
• Gene Symbol: WFDC2
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining