Invitrogen™ Human WNK1 Control Fragment Recombinant Protein

Catalog No.	Quantity
RP95225	100 μL

Catalog No. RP95225 Supplier Invitrogen™ Supplier No. RP95225

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (71%), Rat (71%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

WNK1 serine/threonine kinase is a member of the WNK subfamily. WNK1 may be a key regulator of blood pressure by controlling the transport of sodium and chloride ions. Mutations in this gene have been associated with pseudohypoaldosteronism type II and hereditary sensory neuropathy type II. WNK plays an important role in the regulation of electrolyte homeostasis, cell signaling, survival, and proliferation. Also, acts as an activator and inhibitor of sodium-coupled chloride cotransporters and potassium-coupled chloride cotransporters respectively. Activates SCNN1A, SCNN1B, SCNN1D, and SGK1. WNK localizes to a segment of kidney involved in salt, potassium, and pH homeostasis, the distal nephron. Mutations in the WNK gene result in Pseudohypaldosteronism and Neuropathy.

Specifications

• Accession Number: Q9H4A3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 65125
• Name: Human WNK1 Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 6430573H23Rik; EG406236; Erythrocyte 65 kDa protein; HSAN2; HSN2; hWNK1; KDP; KIAA0344; Kinase deficient protein; MGC163339; MGC163341; mKIAA0344; p65; PPP1R167; Prkwnk1; prostate-derived sterile 20-like kinase; protein kinase lysine-deficient 1; Protein kinase with no lysine 1; protein phosphatase 1, regulatory subunit 167; PSK; Serine/threonine-protein kinase WNK1; serine/threonine-protein kinase WNK1 1; serine/threonine-protein kinase WNK1 2; With no K; WNK lysine deficient protein kinase 1; WNK lysine deficient protein kinase 1 isoform; WNK1
• Common Name: WNK1
• Gene Symbol: WNK1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PPFPAPSLTQSQQPLEDLDAQLRRTLSPEMITVTSAVGPVSMAAPTAITEAGTQPQKGVSQVKEGPVLATSSGAGVFKMGRFQVSVAADGA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining