Invitrogen™ Human WWTR1 (aa 36-175) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP89285	100 μL

Catalog No. RP89285 Supplier Invitrogen™ Supplier No. RP89285

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52431. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

WW domain-containing transcription regulator protein 1 (WWTR1) is a transcriptional coactivator which acts as a downstream regulatory target in the Hippo signaling pathway that plays a pivotal role in organ size control and tumor supression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein STK3/MST2 and STK4/MST1, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1. In turn, MOB1 phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. WWTR1 enhances PAX8 and NKX2-1/TTF1-dependent gene activation. WWTR1 regulates the nuclear accumulation of SMADS and has a key role in coupling them to the transcriptional machinery such as the mediator complex. WWTR1 also regulates embryonic stem-cell self-renewal and promotes cell proliferation and epithelial-mesenchymal transition.

Specifications

• Accession Number: Q9GZV5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 25937
• Name: Human WWTR1 (aa 36-175) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 2310058J06Rik; 2610021I22Rik; C78399; DKFZp586I1419; FLJ27004; FLJ45718; Tafazzin; TAZ; transcriptional coactivator with PDZ binding motif; transcriptional co-activator with PDZ-binding motif; transcriptional coactivator with PDZ-binding motif; transcriptional co-activator with PDZ-binding motif (TA)Z; transcriptional co-activator with PDZ-binding motif (TAZ); WW domain containing transcription regulator 1; WW domain-containing transcription regulator protein 1; Wwtr1
• Common Name: WWTR1
• Gene Symbol: WWTR1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MNPKPSSWRKKILPESFFKEPDSGSHSRQSSTDSSGGHPGPRLAGGAQHVRSHSSPASLQLGTGAGAAGSPAQQHAHLRQQSYDVTDELPLPPGWEMTFTATGQRYFLNHIEKITTWQDPRKAMNQPLNHMNLHPAVSST
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining