Invitrogen™ Human XKR6 (aa 601-641) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP108502	100 μL

Catalog No. RP108502 Supplier Invitrogen™ Supplier No. RP108502

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84668. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

XK is a 444 amino acid protein that spans the membrane 10 times and carries the ubiquitous antigen, Kx, which determines blood type. The XK (X-linked Kx blood group)-related gene family are homologs of XK. XKR6 (XK-related protein 6) is a 641 amino acid multi-pass membrane protein that likely is a component of the XK/Kell complex of the Kell blood group system. The gene encoding XKR6 maps to human chromosome 8, which is made up of nearly 146 million bases and encodes about 800 genes. There are two isoforms of XKR6 that are produced as a result of alternative splicing events.

Specifications

• Accession Number: Q5GH73
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 286046
• Name: Human XKR6 (aa 601-641) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: BC024502; C8orf21; C8orf5; C8orf7; LOW QUALITY PROTEIN: XK-related protein 6; RGD1310719; Transmembrane protein C8orf5; X Kell blood group precursor related family member 6 homolog; X Kell blood group precursor-related family, member 6; XK related 6; XK, Kell blood group complex subunit-related family, member 6; XKR6; XK-related protein 6; X-linked Kx blood group related 6; Xrg6
• Common Name: XKR6
• Gene Symbol: XKR6
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FVDRRLRRTINILQYVTPTAVGIRYRDGPLLYELLQYESSL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining