Invitrogen™ Human XTP4 (aa 61-110) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP101790	100 μL

Catalog No. RP101790 Supplier Invitrogen™ Supplier No. RP101790

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

During the past decade, the role of the ERBB2(neu/HER2) oncogene as an important predictor of patient outcome and response to various therapies in breast cancer has been clearly established. The C35 (C17orf37) is a novel tumor biomarker abundantly expressed in breast cancer. Identification of shared tumor-specific targets is useful in developing broadly applicable therapies. The C35 gene is located on chromosome 17q12, 505nucleotides from the 3' end of the ERBB2oncogene, the antigenic target for trastuzumab(Herceptin) therapy. The chromosomal arrangement of the genes encoding C35 andERBB2 is tail to tail. The ORF 37 open reading frame encodes a 12-kDa protein of unknown function.

Specifications

• Accession Number: Q9BRT3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 84299
• Name: Human XTP4 (aa 61-110) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 1810046J19Rik; AI463380; C16H17orf37; C17orf37; C35; HBV XAg-transactivated protein 4; HBV X-transactivated gene 4 protein; MGC14832; MIEN1; Migration and invasion enhancer 1; ORB3; protein C17orf37; protein C17orf37 homolog; Protein C35; RDX12; RGD1306682; XTP4
• Common Name: XTP4
• Gene Symbol: MIEN1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GTGAFEIEINGQLVFSKLENGGFPYEKDLIEAIRRASNGETLEKITNSRP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining