Invitrogen™ Human YBX1 (aa 271-320) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP106754	100 μL

Catalog No. RP106754 Supplier Invitrogen™ Supplier No. RP106754

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

YBX1 binds to splice sites in pre-mRNA and regulates splice site selection. This protein binds and stabilizes cytoplasmic mRNA and contributes to the regulation of translation by modulating the interaction between the mRNA and eukaryotic initiation factors. It binds to promoters that contain a Y-box (5'-CTGATTGGCCAA-3'), such as HLA class II genes. It regulates the transcription of numerous genes and promotes separation of DNA strands that contain mismatches or are modified by cisplatin. It has endonucleolytic activity and can introduce nicks or breaks into double-stranded DNA (in vitro), and it may play a role in DNA repair.

Specifications

• Accession Number: P67809
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 4904
• Name: Human YBX1 (aa 271-320) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 1700102N10Rik; BP8; BP-8; Byb1; C79409; Cbfa; CBF-A; CCAAT-binding; CCAAT-binding transcription factor 1 subunit A; CCAAT-binding transcription factor I subunit A; CSDA2; CSDB; dbpB; DNA binding protein B; DNA-binding protein B; EF1A; EFI-A; enhancer factor 1 alpha; enhancer factor 1 subunit A; enhancer factor I subunit A; major histocompatibility complex, class II, Y box-binding protein I; MDR NF1; MDR-NF1; MGC104858; MGC110976; MGC117250; Msy1; Msy-1; mYB-1a; Nsep1; NSEP-1; nuclease sensitive element binding protein 1; nuclease-sensitive element-binding protein 1; Y box binding protein 1; Y box protein 1; Y box transcription factor; YB1; YB-1; Y-box binding protein 1; Y-box transcription factor; Y-box-binding protein 1; YBX1
• Common Name: YBX1
• Gene Symbol: YBX1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TQGQQPPQRRYRRNFNYRRRRPENPKPQDGKETKAADPPAENSSAPEAEQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining