Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ Human YRDC (aa 202-273) Control Fragment Recombinant Protein

Catalog No. RP94542
Encompass_Preferred
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP94542 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP94542 Supplier Invitrogen™ Supplier No. RP94542
Add to Cart
Add to Cart

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56366. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

YrdC (yrdC domain containing protein), also known as IRIP (ischemia/reperfusion-inducible protein homolog), SUA5 or DRIP3 (dopamine receptor-interacting protein 3), is a 279 amino acid ubiquitously expressed protein found at highest levels in brain, liver and pancreas. A member of the SUA5 family, yrdC is involved in certain aspects of transporter activity, such as the regulation of efflux transporter activity and cargo assembly. YrdC is a peripheral membrane protein that contains one yrdC-like domain, interacts with RSC1A1 and localizes to mitochondrial and plasma membranes.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q86U90
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 79693
Name Human YRDC (aa 202-273) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias AV303379; BC023823; dopamine receptor interacting protein 3; dopamine receptor-interacting protein 3; DRIP3; hIRIP; IRIP; ischemia/reperfusion inducible protein; Ischemia/reperfusion-inducible protein; Ischemia/reperfusion-inducible protein homolog; ITIP; mIRIP; SUA5; Yrdc; yrdC domain containing; yrdC domain containing (E.coli); yrdC domain-containing protein, mitochondrial; yrdC N(6)-threonylcarbamoyltransferase domain containing; yrdC N6-threonylcarbamoyltransferase domain containing
Common Name YRDC
Gene Symbol YRDC
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ASSLNVEEFQDLWPQLSLVIDGGQIGDGQSPECRLGSTVVDLSVPGKFGIIRPGCALESTTAILQQKYGLLP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.