Invitrogen™ Human ZADH2 (aa 40-145) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP93158	100 μL

Catalog No. RP93158 Supplier Invitrogen™ Supplier No. RP93158

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54418. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ZADH2 (zinc binding alcohol dehydrogenase domain containing 2) is a 377 amino acid protein that belongs to the zinc-containing alcohol dehydrogenase family and is encoded by a gene which maps to human chromosome 18. Chromosome 18 houses over 300 protein-coding genes and contains nearly 76 million bases. There are a variety of diseases associated with defects in chromosome 18-localized genes, some of which include Trisomy 18 (also known as Edwards syndrome), Niemann-Pick disease, hereditary hemorrhagic telangiectasia, erythropoietic protoporphyria and follicular lymphomas.

Specifications

• Accession Number: Q8N4Q0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 284273
• Name: Human ZADH2 (aa 40-145) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 15-oxoprostaglandin 13-reductase; C530046K17Rik; PRG-3; Prostaglandin reductase 3; Prostaglandin reductase-3; PTGR3; PTGR-3; Pthr3; Zadh2; zinc binding alcohol dehydrogenase domain containing 2; zinc binding alcohol dehydrogenase, domain containing 2; zinc-binding alcohol dehydrogenase domain-containing protein 2
• Common Name: ZADH2
• Gene Symbol: Zadh2
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RLSPNFREAVTLSRDCPVPLPGDGDLLVRNRFVGVNASDINYSAGRYDPSVKPPFDIGFEGIGEVVALGLSASARYTVGQAVAYMAPGSFAEYTVVPASIATPVPS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining