Invitrogen™ Human ZBTB3 (aa 1-60) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP104215	100 μL

Catalog No. RP104215 Supplier Invitrogen™ Supplier No. RP104215

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (28%), Rat (28%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57226. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The ZBTB family of proteins is comprised of diverse zinc finger proteins that also contain a BTB (BR-C, ttk and bab) domain. While little is known about ZBTB3, the related protein ZBTB2 is thought to be phosphorylated in response to the DNA damage, probably by either ATM or ATR. Other ZBTB proteins, such as ZBTB4 and ZBTB38 bind methylated DNA and repress transcription, suggesting that ZBTB3 may also act as a transcription repressor.

Specifications

• Accession Number: Q9H5J0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 79842
• Name: Human ZBTB3 (aa 1-60) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 4930563M09Rik; RGD1561140; ZBTB3; zinc finger and BTB domain containing 3; zinc finger and BTB domain-containing protein 3
• Common Name: ZBTB3
• Gene Symbol: ZBTB3
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MLREFSKWGVEASPGKAWERKRSLLRGAVGRYRGATGGDLFWAPFPSWGTMEFPEHSQQL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining