Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP91310

Invitrogen™ Human ZBTB38 (aa 692-817) Control Fragment Recombinant Protein

Catalog No. RP91310
Encompass_Preferred
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP91310 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP91310 Supplier Invitrogen™ Supplier No. RP91310
Only null left
Add to Cart
Add to Cart

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (69%), Rat (69%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ZBTB38 is a methyl CpG binding protein that binds to DNA sequences containing a single methylated CpG, thereby acting as a transcriptional repressor. It has been found to be highly expressed in the brain and may be involved in the differentiation of late postmitotic neurons.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8NAP3
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 253461
Name Human ZBTB38 (aa 692-817) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias A930014K01Rik; CIBZ; CtBP-interacting BTB zinc finger protein; FLJ22332; FLJ31131; FLJ35036; PPP1R171; protein phosphatase 1, regulatory subunit 171; RGD1310136; si:ch73-160p19.2; UniProtKB:Q8BW71}; ZBTB38; zbtb38 {ECO:0000250; zenon; Zenon homolog; zinc finger and BTB domain containing 38; zinc finger and BTB domain-containing protein 38; Zinc finger protein expressed in neurons; zinc finger transcription factor Kaiso; ZNF921
Common Name ZBTB38
Gene Symbol ZBTB38
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PVLSLSNSSENAASVISYSGSAPSVIVHSSQFSSVIMHSNAIAAMTSSNHRAFSDPAVSQSLKDDSKPEPDKVGRFASRPKSIKEKKKTTSHTRGEIPEESNYVADPGGSLSKTTNIAEETSKIET
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.