Invitrogen™ Human ZC3H12C (aa 604-701) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP104189	100 μL

Catalog No. RP104189 Supplier Invitrogen™ Supplier No. RP104189

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58557. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ZC3H12C, also known as MCPIP3, is a member of a family of novel CCCH-zinc finger proteins that includes ZC3H12A, a protein that is thought to be involved in macrophage activation, host immunity and inflammatory diseases. Similar to ZC3H12A, ZC3H12C expression in macrophages is highly increased after treatment with lipopolysaccharide (LPS), suggesting it also may play a role in host immunity and inflammatory response.

Specifications

• Accession Number: Q9C0D7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 85463
• Name: Human ZC3H12C (aa 604-701) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: A230108E06; C230027N18Rik; Kiaa1726; MCP induced protein 3; MCP-induced protein 3; MCPIP3; mKIAA1726; Probable ribonuclease ZC3H12C; RGD1565078; ZC3H12C; Zinc finger CCCH domain-containing protein 12C; zinc finger CCCH type containing 12C; zinc finger CCCH-type containing 12C
• Common Name: ZC3H12C
• Gene Symbol: ZC3H12C
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PRSPERRFSLDTDYRISSVASDCSSEGSMSCGSSDSYVGYNDRSYVSSPDPQLEENLKCQHMHPHSRLNPQPFLQNFHDPLTRGQSYSHEEPKFHHKP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining