Invitrogen™ Human ZFAND2A (aa 68-145) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP92808	100 μL

Catalog No. RP92808 Supplier Invitrogen™ Supplier No. RP92808

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (68%), Rat (68%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53995. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ZFAND2A (AN1-type zinc finger protein 2A) is a 171 amino acid protein containing two AN1-type zinc fingers. AN1-type zinc fingers contain six conserved cysteines, two histidines and have a dimetal (zinc)-bound alpha/beta fold. The gene encoding ZFAND2A maps to human chromosome 7, which houses over 1,000 genes and comprises nearly 5% of the human genome.

Specifications

• Accession Number: Q8N6M9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 90637
• Name: Human ZFAND2A (aa 68-145) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: AIRAP; AN1-type zinc finger protein 2A; arsenite inducible RNA associated protein; ZFAND2A; zinc finger AN1-type containing 2A; zinc finger, AN1-type domain 2A
• Common Name: ZFAND2A
• Gene Symbol: ZFAND2A
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KGQIPDVVVGDHIDRDCDSHPGKKKEKIFTYRCSKEGCKKKEMLQMVCAQCHGNFCIQHRHPLDHSCRHGSRPTIKAG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining