Invitrogen™ Human ZMIZ2 (aa 712-827) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP89718	100 μL

Catalog No. RP89718 Supplier Invitrogen™ Supplier No. RP89718

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59263. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ZIMP7, also known as ZMIZ2, is a novel PIAS (protein inhibitor of activated signal transducer and activator of transcription)-like protein and a transcriptional coactivator. ZIMP7 is expressed most abundantly in testis. The C-terminal proline-rich domain possesses a significant intrinsic transcriptional activity and this activity is inhibited by the N-terminus in the full-length ZIMP7. ZIMP7 and the related protein ZIMP10 interact with PIAS3 and enhances Androgen Receptor (AR)- mediated transcription. The interaction between ZIMP7 and SWI/SNF complex suggests a possible role for ZIMP7 in chromatin modification.

Specifications

• Accession Number: Q8NF64
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 83637
• Name: Human ZMIZ2 (aa 712-827) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: D11Bwg0280e; HRIHFB2007; hZIMP7; KIAA1886; NET27; PIAS-like protein Zimp7; TRAFIP20; Zimp7; zinc finger MIZ domain-containing protein 2; zinc finger MIZ-type containing 2; zinc finger, MIZ-type containing 2; Zmiz2
• Common Name: ZMIZ2
• Gene Symbol: ZMIZ2
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LMPSVMEMIAALGPGAAPFAPLQPPSVPAPSDYPGQGSSFLGPGTFPESFPPTTPSTPTLAEFTPGPPPISYQSDIPSSLLTSEKSTACLPSQMAPAGHLDPTHNPGTPGLHTSNL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining