Invitrogen™ Human ZNF350 (aa 58-182) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP99731	100 μL

Catalog No. RP99731 Supplier Invitrogen™ Supplier No. RP99731

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (25%), Rat (25%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-81951. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ZBRK1 is a member of the Kruppel-associated box-zinc finger protein (KRAB-ZFP) protein family of transcriptional repressors. ZBRK1 has been shown to not only be up-regulated in senescent fibroblasts but also interacts with BRCA1, a transcriptional regulator with tumor suppressor activity. ZBRK1 binds to a specific sequence within the GADD45 gene, supporting the assembly of a nuclear complex containing BRCA1 and repressing its transcription. Recent experiments demonstrate that ZBRK1 can homo-oligomerize in vitro and in vivo through a C-terminal transcriptional repression domain (CTRD), and this oligomerization facilitates the ZBRK1-directed transcriptional repression through ZBRK1 response elements. These results suggest that higher order ZBRK1 oligomers may assemble through both protein-DNA and CTRD-dependent protein-protein interactions.

Specifications

• Accession Number: Q9GZX5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 59348
• Name: Human ZNF350 (aa 58-182) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: KRAB zinc finger protein ZFQR; ZBRK1; ZFQR; Zinc finger and BRCA1-interacting protein with a KRAB domain 1; zinc finger protein 350; Zinc finger protein ZBRK1; zinc-finger protein ZBRK1; ZNF350
• Common Name: ZNF350
• Gene Symbol: ZNF350
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FKLEQGEQLWTIEDGIHSGACSDIWKVDHVLERLQSESLVNRRKPCHEHDAFENIVHCSKSQFLLGQNHDIFDLRGKSLKSNLTLVNQSKGYEIKNSVEFTGNGDSFLHANHERLHTAIKFPASQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining