Invitrogen™ Human ZNF50 (aa 128-239) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP89416	100 μL

Catalog No. RP89416 Supplier Invitrogen™ Supplier No. RP89416

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (48%), Rat (48%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52299. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Zinc-finger proteins contain DNA-binding domains and have a wide variety of functions, most of which encompass some form of transcriptional activation or repression. The majority of zinc-finger proteins contain a Krueppel-type DNA binding domain and a KRAB domain, which is thought to interact with KAP1, thereby recruiting histone modifying proteins. ZSCAN22 (zinc finger and SCAN domain-containing protein 22), also known as HKR2 or ZNF50 (zinc finger protein 50), is a 491 amino acid nuclear protein. Belonging to the Krueppel C2 H2-type zinc-finger protein family, ZSCAN22 contains eight C2 H2-type zinc fingers and one SCAN box domain. ZSCAN22 may be involved in transcriptional regulation, and becomes phosphorylated upon DNA damage.

Specifications

• Accession Number: P10073
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 342945
• Name: Human ZNF50 (aa 128-239) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: AW227621; D530006B18Rik; GLI-Kruppel family member HKR2; HKR2; Krueppel-related zinc finger protein 2; LOC102553002; Protein HKR2; zinc finger and SCAN domain containing 22; zinc finger and SCAN domain-containing protein 22; Zinc finger protein 50; zinc finger protein 8-like; ZNF50; ZSCAN22
• Common Name: ZNF50
• Gene Symbol: ZSCAN22
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TQVLDKRGWDPGAEPTEASCKQSDLGESEPSNVTETLMGGVSLGPAFVKACEPEGSSERSGLSGEIWTKSVTQQIHFKKTSGPYKDVPTDQRGRESGASRNSSSAWPNLTSQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining