Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ Human ZNF521 (aa 1077-1150) Control Fragment Recombinant Protein

Catalog No. RP93655
Encompass_Preferred
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP93655 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP93655 Supplier Invitrogen™ Supplier No. RP93655
Add to Cart
Add to Cart

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54680. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The zinc finger protein 521 (ZNF521) is a transcription factor containing an N-terminal transcriptional repressor motif and 30 zinc finger domains. It plays a role in both erythroid cell and osteoblast differentiation during development, inhibiting the activities of early B-cell factor 1 (EBF1) in erythroid cells and Runx2 in osteoblast precursors. ZFP521 binds to both Runx2 and histone deacetylase 3 (HDAC3), promotes their association and antagonizes Runx2 transcriptional activity in a HDAC3-dependent manner, thereby regulating osteoblast differentiation, skeletal development, and bone homeostasis.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q96K83
Concentration 4.7 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 25925
Name Human ZNF521 (aa 1077-1150) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias B930086A16Rik; early hematopoietic zinc finger protein; Ecotropic viral integration site 3 protein; EHZF; Evi3; LIP3; LYST-interacting protein 3; Zfp521; Zinc finger protein 521; Znf521
Common Name ZNF521
Gene Symbol ZNF521
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KQDLVKLDINGLPYGLCAGCVNLSKSASPGINVPPGTNRPGLGQNENLSAIEGKGKVGGLKTRCSSCNVKFESE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.