Invitrogen™ Human ZNF638 (aa 306-396) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP106774	100 μL

Catalog No. RP106774 Supplier Invitrogen™ Supplier No. RP106774

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (68%), Rat (68%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84342. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Zinc-finger proteins contain DNA-binding domains and have a wide variety of functions, most of which encompass some form of transcriptional activation or repression. NP220 (Nuclear protein 220), also designated Zinc finger protein 638 (ZNF638) or Cutaneous T-cell lymphoma-associated antigen se33-1, is a 1978 amino acid protein that contains one matrin-type zinc finger and two RRM (RNA recognition motif) domains, suggesting a role in transcriptional regulation. NP220 binds to double-stranded DNA fragments by recognizing clusters of cytidines. NP220 interacts with FHL-2 and is also thought to be phosphorylated by ATM or ATR upon DNA damage. It exists as five isoforms as a result of alternative splicing events. Isoform five of NP220 is a tumor-associated antigen found in several cutaneous T-cell lymphoma (CTCL), and in particular in mycosis fungoides patients and in Sezary syndrome patients.

Specifications

• Accession Number: Q14966
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 27332
• Name: Human ZNF638 (aa 306-396) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: AI323587; CTCL tumor antigen se33-1; CTCL-associated antigen se33-1; Cutaneous T-cell lymphoma-associated antigen se33-1; mNP220; Np220; NP220 nuclear protein; nuclear protein 220; Zfml; Zfp638; Zinc finger matrin-like protein; zinc finger protein 638; zinc finger, matrin-like; Znf638
• Common Name: ZNF638
• Gene Symbol: ZNF638
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EPIKSVNQSINQTVSQTMSQSLIPPSMNQQPFSSELISSVSQQERIPHEPVINSSNVHVGSRGSKKNYQSQADIPIRSPFGIVKASWLPKF
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining