Invitrogen™ Human ZNF83 (aa 2-151) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP89397	100 μL

Catalog No. RP89397 Supplier Invitrogen™ Supplier No. RP89397

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (40%), Rat (40%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55281. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The ZNF83 gene encodes a zinc-finger protein belonging to a large family of transcription factors that play essential roles in regulating gene expression by interacting with DNA. Located on chromosome 3, ZNF83 is particularly notable for its recurrent mutations in cancer. For instance, the p.E293V missense mutation in ZNF83 has been frequently observed in bladder cancer patients, accounting for 18% of cases, and is associated with poor prognosis. This mutation disrupts the gene's tumor suppressor function, promoting increased tumor growth. Due to its significant role in tumorigenesis, ZNF83 is actively studied in cancer research as a potential biomarker and therapeutic target.

Specifications

• Accession Number: P51522
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 55769
• Name: Human ZNF83 (aa 2-151) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: HPF1; zinc finger protein 816B; Zinc finger protein 83; zinc finger protein HPF1; ZNF816B; ZNF83
• Common Name: ZNF83
• Gene Symbol: ZNF83
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: HGRKDDAQKQPVKNQLGLNPQSHLPELQLFQAEGKIYKYDHMEKSVNSSSLVSPPQRISSTVKTHISHTYECNFVDSLFTQKEKANIGTEHYKCSERGKAFHQGLHFTIHQIIHTKETQFKCDICGKIFNKKSNLASHQRIHTGEKPYKC
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining