Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CPC Scientific H-Ala-Val-Ser-Glu-His-Gln-Leu-Leu-His-Asp-Lys-Gly-Lys-Ser-Ile-Gln-Asp-Leu-Arg-Arg-Arg-Phe-Phe-Leu-His-His-Leu-Ile-Ala-Glu-Ile-His-Thr-Ala-Glu-Ile-Arg-Ala-Thr-Ser-OH (trifluoroacetate salt) 1MG
SDP

Supplier:  CPC Scientific PTHP012A

Encompass

A parathyroid hormone (PTH)-related peptide (1-40), human.ONE-LETTER SEQUENCE: AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATSMOLECULAR FORMULA: C207H334N66O58MOLECULAR WEIGHT:4675.34STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [120298-73-9], SYNONYMS: pTH-Related Protein (1-40) (human, mouse, rat)RESEARCH AREA: Osteoporosis

Catalog No. 50-211-0351


May include imposed supplier surcharges.
Only null left
Add to Cart

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.