Learn More
CPC Scientific H-Ala-Val-Ser-Glu-His-Gln-Leu-Leu-His-Asp-Lys-Gly-Lys-Ser-Ile-Gln-Asp-Leu-Arg-Arg-Arg-Phe-Phe-Leu-His-His-Leu-Ile-Ala-Glu-Ile-His-Thr-Ala-Glu-Ile-Arg-Ala-Thr-Ser-OH (trifluoroacetate salt) 1MG

Supplier: CPC Scientific PTHP012A
A parathyroid hormone (PTH)-related peptide (1-40), human.ONE-LETTER SEQUENCE: AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATSMOLECULAR FORMULA: C207H334N66O58MOLECULAR WEIGHT:4675.34STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [120298-73-9], SYNONYMS: pTH-Related Protein (1-40) (human, mouse, rat)RESEARCH AREA: Osteoporosis
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.