Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CPC Scientific H-Ala-Val-Ser-Glu-His-Gln-Leu-Leu-His-Asp-Lys-Gly-Lys-Ser-Ile-Gln-Asp-Leu-Arg-Arg-Arg-Phe-Phe-Leu-His-His-Leu-Ile-Ala-Glu-Ile-His-Thr-Ala-OH (trifluoroacetate salt) 0.5MG
SDP

Supplier:  CPC Scientific PTHP005A

Encompass

Peptide found to have anabolic effect on bone formation in rats that can inhibit the rapid decline in bone formation due to denervation.ONE-LETTER SEQUENCE: AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAMOLECULAR FORMULA: C180H287N57O48MOLECULAR WEIGHT:4016.57STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [112955-31-4], RESEARCH AREA: OsteoporosisREFERENCES: L.J. Suva et al., Science, 237, 893 (1987)

Catalog No. 50-211-0341


May include imposed supplier surcharges.
Add to Cart

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.