Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Novus Biologicals™ IDH3B Recombinant Protein Antigen
Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition
Supplier: Novus Biologicals™ NBP258706PEP
Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IDH3B. Source: E.coli Amino Acid Sequence: TAMLLSASNMLRHLNLEYHSSMIADAVKKVIKVGKVRTRDMGGYSTTTDFIKSVIGHLQTKGS The IDH3B Recombinant Protein Antigen is derived from E. coli. The IDH3B Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.Specifications
| 3420 | |
| IDH3B Recombinant Protein Antigen | |
| PBS and 1M Urea, pH 7.4. | |
| EC 1.1.1, EC 1.1.1.41, FLJ11043, H-IDHB, isocitrate dehydrogenase [NAD] subunit beta, mitochondrial, isocitrate dehydrogenase 3 (NAD+) beta, isocitrate dehydrogenase, NAD(+)-specific, mitochondrial, beta subunit, Isocitric dehydrogenase subunit beta, MGC9 | |
| Unlabeled | |
| 100μL | |
| E.coli |
| >80% by SDS-PAGE and Coomassie blue staining | |
| Store at −20°C. Avoid freeze-thaw cycles. | |
| Blocking/Neutralizing, Control | |
| IDH3B | |
| Recombinant Protein Antigen | |
| RUO | |
| Human |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
For Research Use Only.