Novus Biologicals™ IFTAP Recombinant Protein Antigen

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

Supplier:  Novus Biologicals™ NBP183472PEP

Catalog No. NBP183472PE

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human C11ORF74. The C11orf74 Recombinant Protein Antigen is derived from E. coli. The C11orf74 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

Specifications

• Gene ID (Entrez): 119710
• Purification Method: Chromatography
• Concentration: 0.5mg/mL
• Formulation: PBS and 1M Urea, pH 7.4.
• Gene Alias: chromosome 11 open reading frame 74, FLJ38678, HEPIS, hypothetical protein LOC119710, NWC, Protein HEPIS
• Label Type: Unlabeled
• Product Type: C11orf74
• Regulatory Status: RUO
• Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83472. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
• Target Gene: IFTAP

• Species: Human
• Purity: >80%
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• For Use With (Application): Blocking/Neutralizing, Control
• Gene Symbol: C11ORF74
• Molecular Weight (g/mol): 25kDa
• Quantity: 0.1mL
• Source: E.Coli
• Immunogen: MSAHMSGLEIMDEDQLIKDVLDKFLNCHEQTYDEEFLNTFTHLSQEDHVSKRGVFGTDSSE

Safety and Handling

ShelfLife : 365

For Research Use Only