Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Abnova™ JAG1 (Human) Recombinant Protein (Q01)

Catalog No. 89020368 Shop All Abnova Corporation Products
Click to view available options
Quantity:
10 μg
25 μg

Human JAG1 partial ORF with GST-tag at N-terminal

The jagged 1 protein encoded by JAG1 is the human homolog of the Drosophilia jagged protein. Human jagged 1 is the ligand for the receptor notch 1, the latter a human homolog of the Drosophilia jagged receptor notch. Mutations that alter the jagged 1 protein cause Alagille syndrome. Jagged 1 signalling through notch 1 has also been shown to play a role in hematopoiesis.

  • Theoretical MW: 35.64kDa
  • Preparation Method: In vitro wheat germ expression system
  • Purification: Glutathione Sepharose 4 Fast Flow
  • Storage Buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer

Best use within three months from the date of receipt of this protein

Enzyme Linked Immunosorbent Assay, Western Blotting, Antibody Production, Protein Array

Specifications

Accession Number NP_000205
For Use With (Application) Antibody Production, ELISA, Protein Array, Western Blot
Formulation 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Gene ID (Entrez) 182
Molecular Weight (g/mol) 35.64
Name JAG1 (Human) Recombinant Protein (Q01)
pH Range 8
Preparation Method In vitro wheat germ expression system
Purification Method Glutathione Sepharose 4 Fast Flow
Quality Control Testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Quantity 10 μg
Source Wheat Germ (in vitro)
Immunogen PNPCQNGAQCYNRASDYFCKCPEDYEGKNCSHLKDHCRTTPCEVIDSCTVAMASNDTPEGVRYISSNVCGPHGKCKSQSGGKFTCDCNKG
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Alias AGS/AHD/AWS/CD339/HJ1/JAGL1/MGC104644
Common Name JAG1
Gene Symbol JAG1
Cross Reactivity Human
Species Wheat Germ (in vitro)
Recombinant Recombinant
Protein Tag GST
Form Solution
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.