Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Novus Biologicals™ JAKMIP2 Recombinant Protein Antigen
Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition
Supplier: Novus Biologicals™ NBP257711PEP
Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human JAKMIP2. Source: E.coli Amino Acid Sequence: RETEKQCKPLLERNKCLAKRNDELMVSLQRMEEKLKAVTKENSEMREKITSHPPLKKLKSLNDLDQANEEQ The JAKMIP2 Recombinant Protein Antigen is derived from E. coli. The JAKMIP2 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.Specifications
| 9832 | |
| JAKMIP2 Recombinant Protein Antigen | |
| PBS and 1M Urea, pH 7.4 | |
| CTCL tumor antigen HD-CL-04, JAMIP2KIAA0555Jak and microtubule interacting protein 2, janus kinase and microtubule interacting protein 2, janus kinase and microtubule-interacting protein 2, NECC1, neuroendocrine long coiled-coil 1, Neuroendocrine long coi | |
| Unlabeled | |
| 100μL | |
| E.coli |
| >80% by SDS-PAGE and Coomassie blue staining | |
| Store at −20°C. Avoid freeze-thaw cycles | |
| Blocking/Neutralizing, Control | |
| JAKMIP2 | |
| Recombinant Protein Antigen | |
| RUO | |
| Human |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
For research use only.