Novus Biologicals™ JAKMIP2 Recombinant Protein Antigen

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

Supplier:  Novus Biologicals™ NBP257711PEP

Catalog No. NBP257711PE

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human JAKMIP2. Source: E.coli Amino Acid Sequence: RETEKQCKPLLERNKCLAKRNDELMVSLQRMEEKLKAVTKENSEMREKITSHPPLKKLKSLNDLDQANEEQ The JAKMIP2 Recombinant Protein Antigen is derived from E. coli. The JAKMIP2 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

Specifications

• Gene ID (Entrez): 9832
• Common Name: JAKMIP2 Recombinant Protein Antigen
• Formulation: PBS and 1M Urea, pH 7.4
• Gene Alias: CTCL tumor antigen HD-CL-04, JAMIP2KIAA0555Jak and microtubule interacting protein 2, janus kinase and microtubule interacting protein 2, janus kinase and microtubule-interacting protein 2, NECC1, neuroendocrine long coiled-coil 1, Neuroendocrine long coi
• Label Type: Unlabeled
• Quantity: 100μL
• Source: E.coli

• Purification Method: >80% by SDS-PAGE and Coomassie blue staining
• Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
• For Use With (Application): Blocking/Neutralizing, Control
• Gene Symbol: JAKMIP2
• Product Type: Recombinant Protein Antigen
• Regulatory Status: RUO
• Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52839. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml

For research use only.