Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. 502109621

CPC Scientific H-Ile-Pro-Ala-Pro-Gln-Gly-Ala-Val-Leu-Val-Gln-Arg-Glu-Lys-Asp-Leu-Pro-Asn-Tyr-Asn-Trp-Asn-Ser-Phe-Gly-Leu-Arg-Phe-NH2 (trifluoroacetate salt) 1MG
SDP

Supplier:  CPC Scientific KISS003A

Encompass

An LRF-amide motif containing fragment of malignant melanoma metastasis-suppressor Kiss1 which binds to human GPR54, a G-protein-coupled receptor also known as AXOR12. It shows lower agonistic potency towards AXOR12 than malignant melanoma metastasis-suppressor Kisspeptin-13 (4-13) (human) (H-5544).ONE-LETTER SEQUENCE: IPAPQGAVLVQREKDLPNYNWNSFGLRF-NH2MOLECULAR FORMULA: C149H226N42O39MOLECULAR WEIGHT:3229.69STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [1135442-77-1], SYNONYMS: Metastin (27-54) (human), KiSS-1 (94-121) (human), Malignant Melanoma Metastasis-Suppressor KiSS-1 (94-121) (human)RESEARCH AREA: CancerREFERENCES: A.West et al., Genomics, 54, 145 (1998); A.I.Muir et al., J. Biol. Chem., 276, 28969 (2001)

Catalog No. 50-210-9621


May include imposed supplier surcharges.
Only null left
Add to Cart

Product Content Correction

The Fisher Scientific Encompass Program offers items which are not part of our distribution portfolio. These products typically do not have pictures or detailed descriptions. However, we are committed to improving your shopping experience. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.