Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CPC Scientific H-Ile-Pro-Ala-Pro-Gln-Gly-Ala-Val-Leu-Val-Gln-Arg-Glu-Lys-Asp-Leu-Pro-Asn-Tyr-Asn-Trp-Asn-Ser-Phe-Gly-Leu-Arg-Phe-NH2 (trifluoroacetate salt) 5MG
SDP

Supplier:  CPC Scientific KISS003B

Encompass

An LRF-amide motif containing fragment of malignant melanoma metastasis-suppressor Kiss1 which binds to human GPR54, a G-protein-coupled receptor also known as AXOR12. It shows lower agonistic potency towards AXOR12 than malignant melanoma metastasis-suppressor Kisspeptin-13 (4-13) (human) (H-5544).ONE-LETTER SEQUENCE: IPAPQGAVLVQREKDLPNYNWNSFGLRF-NH2MOLECULAR FORMULA: C149H226N42O39MOLECULAR WEIGHT:3229.69STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [1135442-77-1], SYNONYMS: Metastin (27-54) (human), KiSS-1 (94-121) (human), Malignant Melanoma Metastasis-Suppressor KiSS-1 (94-121) (human)RESEARCH AREA: CancerREFERENCES: A.West et al., Genomics, 54, 145 (1998); A.I.Muir et al., J. Biol. Chem., 276, 28969 (2001)

Catalog No. 50-210-9622


May include imposed supplier surcharges.
Add to Cart

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.