Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. 502110069

CPC Scientific H-Cys-Asp-Ala-Thr-Cys-Gln-Phe-Arg-Lys-Ala-Ile-Asp-Asp-Cys-Gln-Lys-Gln-Ala-His-His-Ser-Asn-Val-Pro-Gly-Asn-Ser-Val-Phe-Lys-Glu-Cys-Met-Lys-Gln-Lys-Lys-Glu-Phe-Lys-Ala-NH2 (trifluoroacetate salt) 1MG
SDP

Supplier:  CPC Scientific PACR001B

Encompass

PAC1 receptor antagonistONE-LETTER SEQUENCE: CDATCQFRKAIDDCQKQAHHSNVPGNSVFKECMKQKKEFKA-NH2 (Cys1 & Cys5, Cys14 & Cys32 bridge)MOLECULAR FORMULA: C199H314N62O60S5MOLECULAR WEIGHT:4695.39STORAGE CONDITIONS: -20 5CRESEARCH AREA: MiscellaneousREFERENCES: O.Moro et al., J. Biol. Chem., 274, 23103 (1999); E.A.Lerner et al., Peptides, 28, 1651 (2007)

Catalog No. 50-211-0069


May include imposed supplier surcharges.
Add to Cart

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.