Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

enQuire Bioreagents Calponin-1 Anti-Human Monoclonal [Clone SPM169], Size: 100ug

Supplier:  enQuire Bioreagents 4214MSM1P1

Encompass_Preferred

Product Type: Antibody. Application: Flow, IF, WB, IHC. Conjugate/Tag: Unconjugated. Clone: 2F6. Clonality: Monoclonal. Host: Mouse. Isotype: IgG2a kappa. Positive Control: A431, HeLa or HL-60 cells or liver tissue. Cellular Staining: Cytoplasmic. Buffer: 10mM PBS with 0.05% BSA & 0.05% azide. Concentration: 200ug/ml. Purity: Protein A/G Purified. Immunogen: Partial recombinant MAP3K1 (aa1211-1310) (SKNSMTLDLNSSSKCDDSFGCSSNSSNAVIPSDETVFTP-VEEKCRLDVNTELNSSIEDLLEASMPSSDTTVTFKSEVAVLSPEKAENDDTYKDDVNHNQK). Storage: Short term: Store at 2-4C. Long term, aliquot and store at -20C. MW: 195kDa (intact); 80kDa (cleaved).Chromosome: 5q11.2. Gene Symbol: MAP3K1. Gene ID: 4214. Ensemble: ENSG00000095015. Uniprot: XP_016864973.

Catalog No. 50-188-4928


May include imposed supplier surcharges.
Add to Cart

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.