Novus Biologicals™ Mind Bomb 2/MIB2 Recombinant Protein Antigen

Description

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Mind Bomb 2/MIB2. Source: E.coli Amino Acid Sequence: PNIICDCCKKHGLRGMRWKCRVCLDYDLCTQCYMHNKHELAHAFDRYETAHSRPVTLSPRQGLPRIPLRGIFQ The Mind Bomb 2/MIB2 Recombinant Protein Antigen is derived from E. coli. The Mind Bomb 2/MIB2 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

Specifications

• Gene ID (Entrez): 142678
• Purification Method: >80% by SDS-PAGE and Coomassie blue staining
• Common Name: Mind Bomb 2/MIB2 Recombinant Protein Antigen
• Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
• Formulation: PBS and 1M Urea, pH 7.4
• For Use With (Application): Blocking/Neutralizing, Control
• Gene Alias: E3 ubiquitin-protein ligase MIB2, EC 6.3.2, EC 6.3.2.-, EC 6.3.2.13, FLJ20648, FLJ41406, Mind bomb homolog 2, mindbomb homolog 2 (Drosophila), Novel zinc finger protein, novelzin, Putative NF-kappa-B-activating protein 002N, SKD, Skeletrophin, Zinc finger
• Gene Symbol: MIB2
• Label Type: Unlabeled
• Product Type: Recombinant Protein Antigen
• Quantity: 100 μL
• Regulatory Status: RUO
• Source: E.coli
• Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53086. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml

For research use only.