Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Creative Biolabs MOUSE ANTI-EHV4 ORF74 1MG
SDP

Supplier:  Creative Biolabs VRH03091F

Encompass

Mouse Anti-EHV4 ORF74 (KKPPTLPRVHVKTPPPILVPQVTPEAHTDFI) Monoclonal Antibody (03091YF) (CAT#: VRH-03091F)This mouse monoclonal antibody 03091YF is generated from premade hybridoma library, and specific for Equid alphaherpesvirus 4 ORF74 (AA 169-199): KKPPTLPRVHVKTPPPILVPQVTPEAHTDFI. For any additional requirments, please specify and submit an inquiry for assistance.

Catalog No. NC2235668


May include imposed supplier surcharges.
Add to Cart
Request a Quote
This item is not returnable. View return policy

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.