Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 89940701

Abnova™ Mouse Csf2 (P01587, 18 a.a. - 141 a.a.) Partial Recombinant Protein

Catalog No. 89940701 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
20 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-940-701 20 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-940-701 Supplier Abnova™ Supplier No. P4355
Only null left
Add to Cart
Add to Cart

Description

Used for Func, SDS-PAGE

Sequence: APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPGQK

Specifications

Accession Number P01587
For Use With (Application) Functional Study, SDS-PAGE
Formulation Lyophilized
Gene ID (Entrez) 12981
Molecular Weight (g/mol) 14kDa
Name Csf2 (Mouse) Recombinant Protein
Preparation Method Escherichia coli expression system
Purification Method Ion exchange column and HPLC reverse phase column
Quantity 20 μg
Immunogen APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPGQK
Storage Requirements Store at -20°C on dry atmosphere for 2 years. After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months. Aliquot to avoid repeated freezing and thawing.
Regulatory Status RUO
Endotoxin Concentration <0.1ng/μg (1EU/μg) (determined by LAL gel clot method)
Gene Alias Csfgm/Gm-CSf/MGC151255/MGC151257/MGI-IGM
Common Name Csf2
Gene Symbol Csf2
Biological Activity The ED50 was determined by the dose-dependent stimulation of the proliferation of murine FDC-P1 cells is ≤ 0.1ng/mL, corresponding to a specific activity of ≥ 3 x 106 units/mg.
Species E. coli
Recombinant Recombinant
Protein Tag None
Expression System Escherichia coli expression system
Form Lyophilized
Purity or Quality Grade >90% by SDS-PAGE and HPLC
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.