Abnova™ Mouse Csf2 (P01587, 18 a.a. - 141 a.a.) Partial Recombinant Protein

Description

Used for Func, SDS-PAGE

Sequence: APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPGQK

Specifications

• Accession Number: P01587
• For Use With (Application): Functional Study, SDS-PAGE
• Formulation: Lyophilized
• Gene ID (Entrez): 12981
• Molecular Weight (g/mol): 14kDa
• Name: Csf2 (Mouse) Recombinant Protein
• Preparation Method: Escherichia coli expression system
• Purification Method: Ion exchange column and HPLC reverse phase column
• Quantity: 20 μg
• Immunogen: APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPGQK
• Storage Requirements: Store at -20°C on dry atmosphere for 2 years. After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Endotoxin Concentration: <0.1ng/μg (1EU/μg) (determined by LAL gel clot method)
• Gene Alias: Csfgm/Gm-CSf/MGC151255/MGC151257/MGI-IGM
• Common Name: Csf2
• Gene Symbol: Csf2
• Biological Activity: The ED50 was determined by the dose-dependent stimulation of the proliferation of murine FDC-P1 cells is ≤ 0.1ng/mL, corresponding to a specific activity of ≥ 3 x 10⁶ units/mg.
• Species: E. coli
• Recombinant: Recombinant
• Protein Tag: None
• Expression System: Escherichia coli expression system
• Form: Lyophilized
• Purity or Quality Grade: >90% by SDS-PAGE and HPLC