Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CPC Scientific H-Glu-Ile-Gly-Asp-Glu-Glu-Asn-Ser-Ala-Lys-Phe-Pro-Ile-Gly-Arg-Arg-Asp-Phe-Asp-Met-Leu-Arg-Cys-Met-Leu-Gly-Arg-Val-Tyr-Arg-Pro-Cys-Trp-Gln-Val-OH (trifluoroacetate salt) 0.5MG
Supplier: CPC Scientific MCH003A
Neuropeptide EI-Gly-Arg-Arg-MCH (human, mouse, rat) has been shown to be more potent in stimulating feeding in the rat than MCH following intracerebroventricular administration although it did not exhibit better agonist activity in in vitro assays. Its enhanced activity in feeding behaviour compared to MCH might be due to its reduced susceptibility to proteolytic degradation by MCH-degrading enzymes such as endopeptidase 24.11 and aminopeptidase M.ONE-LETTER SEQUENCE: EIGDEENSAKFPIGRRDFDMLRCMLGRVYRPCWQVMOLECULAR FORMULA: C182H282N54O52S4MOLECULAR WEIGHT:4186.84STORAGE CONDITIONS: -20 5CRESEARCH AREA: HormonalREFERENCES: A.Viale et al., J. Biol. Chem., 274, 6536 (1999); L.Maulon-Feraille et al., J. Pharmacol. Exp. Ther., 302, 766 (2002)
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?